PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G61890.1
Common NameATHB12, ATHB-12, F21F14.60, HB-12
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family HD-ZIP
Protein Properties Length: 235aa    MW: 27485.4 Da    PI: 4.9093
Description homeobox 12
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G61890.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox54.81.6e-173283556
                 SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox  5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                  +f++eq++ Le  Fe++  +  +++ + A++lgL+ rqV +WFqN+Ra++k
  AT3G61890.1 32 KRFSEEQIKSLELIFESETRLEPRKKVQVARELGLQPRQVAIWFQNKRARWK 83
                 68*************************************************9 PP

2HD-ZIP_I/II117.95.5e-3830121293
  HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                  +++r+s+eq+k+LE  Fe+e++Lep++Kv++areLglqprqva+WFqn+RAR+ktkqlEk+y++L+++y++l+++ e ++ke+++L +el++
  AT3G61890.1  30 NQKRFSEEQIKSLELIFESETRLEPRKKVQVARELGLQPRQVAIWFQNKRARWKTKQLEKEYNTLRANYNNLASQFEIMKKEKQSLVSELQR 121
                  689*************************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.92E-17987IPR009057Homeodomain-like
SMARTSM003897.9E-132289IPR001356Homeobox domain
PROSITE profilePS5007116.6652585IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.606.6E-173192IPR009057Homeodomain-like
PfamPF000461.5E-143283IPR001356Homeobox domain
CDDcd000867.57E-133386No hitNo description
PRINTSPR000312.7E-55665IPR000047Helix-turn-helix motif
PROSITE patternPS0002706083IPR017970Homeobox, conserved site
PRINTSPR000312.7E-56581IPR000047Helix-turn-helix motif
PfamPF021831.9E-1585127IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
GO:0009414Biological Processresponse to water deprivation
GO:0009615Biological Processresponse to virus
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000016anatomylateral root primordium
PO:0000017anatomyvascular leaf primordium
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0006343anatomyaxillary shoot system
PO:0008019anatomyleaf lamina base
PO:0009001anatomyfruit
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0009053anatomypeduncle
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    Send to blast
MEEGDFFNCC FSEISSGMTM NKKKMKKSNN QKRFSEEQIK SLELIFESET RLEPRKKVQV  60
ARELGLQPRQ VAIWFQNKRA RWKTKQLEKE YNTLRANYNN LASQFEIMKK EKQSLVSELQ  120
RLNEEMQRPK EEKHHECCGD QGLALSSSTE SHNGKSEPEG RLDQGSVLCN DGDYNNNIKT  180
EYFGFEEETD HELMNIVEKA DDSCLTSSEN WGGFNSDSLL DQSSSNYPNW WEFWS
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.255170.0floral meristem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306955070.0
Genevisible251272_at0.0
Expression AtlasAT3G61890-
AtGenExpressAT3G61890-
ATTED-IIAT3G61890-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:16055682, ECO:0000269|PubMed:9617808}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a homeodomain leucine zipper class I (HD-Zip I) protein. Loss of function mutant has abnormally shaped leaves and stems.
UniProtProbable transcription activator that may act as growth regulators in response to water deficit. {ECO:0000269|PubMed:11374882, ECO:0000269|PubMed:15604708}.
Function -- GeneRIF ? help Back to Top
  1. ATHB12 negatively regulates the expression of a gibberellin 20-oxidase gene in inflorescence stems.
    [PMID: 20668225]
  2. results suggest that ATHB7 and ATHB12 may play an important role in the activation of the abnormal cell division associated with symptom development during geminivirus infection
    [PMID: 21625602]
  3. demonstrate that ATHB7 and ATHB12 have essential functions in the primary response to drought, as mediators of a negative feedback effect on ABA signalling in the plant response to water deficit
    [PMID: 22968620]
  4. The results suggested that AtHB7 and AtHB12 evolved divergently to fine tune processes associated with development and responses to mild water stress.
    [PMID: 24884528]
  5. ATHB12 acts as a positive regulator of endoreduplication and cell growth during leaf development.
    [PMID: 25187356]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00013PBM24477691Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G61890.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By water deficit, by abscisic acid (ABA), by cold and salt stress. {ECO:0000269|PubMed:15369784, ECO:0000269|PubMed:16055682, ECO:0000269|PubMed:9617808}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT4G25420(R)
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDabscisic acid
Interaction ? help Back to Top
Source Intact With
BioGRIDAT5G37260, AT5G54230, AT5G65310, AT1G10585, AT1G53170
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G61890
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0598280.0AY059828.1 Arabidopsis thaliana homeobox-leucine zipper protein ATHB-12 (F21F14.6) mRNA, complete cds.
GenBankAY0871870.0AY087187.1 Arabidopsis thaliana clone 32615 mRNA, complete sequence.
GenBankBT0022060.0BT002206.1 Arabidopsis thaliana homeobox-leucine zipper protein ATHB-12 (At3g61890) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_191748.11e-175homeobox-leucine zipper protein ATHB-12
SwissprotQ9M2761e-177ATB12_ARATH; Homeobox-leucine zipper protein ATHB-12
TrEMBLD7LSQ41e-142D7LSQ4_ARALL; ATHB-12
STRINGAT3G61890.11e-174(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24982874
Representative plantOGRP12916189
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Johannesson H,Wang Y,Engström P
    DNA-binding and dimerization preferences of Arabidopsis homeodomain-leucine zipper transcription factors in vitro.
    Plant Mol. Biol., 2001. 45(1): p. 63-73
    [PMID:11247607]
  3. Lee YH, et al.
    Structure and expression of the Arabidopsis thaliana homeobox gene Athb-12.
    Biochem. Biophys. Res. Commun., 2001. 284(1): p. 133-41
    [PMID:11374882]
  4. Bray EA
    Classification of genes differentially expressed during water-deficit stress in Arabidopsis thaliana: an analysis using microarray and differential expression data.
    Ann. Bot., 2002. 89 Spec No: p. 803-11
    [PMID:12102506]
  5. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  6. Shin D, et al.
    Athb-12, a homeobox-leucine zipper domain protein from Arabidopsis thaliana, increases salt tolerance in yeast by regulating sodium exclusion.
    Biochem. Biophys. Res. Commun., 2004. 323(2): p. 534-40
    [PMID:15369784]
  7. Olsson AS,Engström P,Söderman E
    The homeobox genes ATHB12 and ATHB7 encode potential regulators of growth in response to water deficit in Arabidopsis.
    Plant Mol. Biol., 2004. 55(5): p. 663-77
    [PMID:15604708]
  8. Henriksson E, et al.
    Homeodomain leucine zipper class I genes in Arabidopsis. Expression patterns and phylogenetic relationships.
    Plant Physiol., 2005. 139(1): p. 509-18
    [PMID:16055682]
  9. Moes D,Himmelbach A,Korte A,Haberer G,Grill E
    Nuclear localization of the mutant protein phosphatase abi1 is required for insensitivity towards ABA responses in Arabidopsis.
    Plant J., 2008. 54(5): p. 806-19
    [PMID:18298671]
  10. Huang D,Wu W,Abrams SR,Cutler AJ
    The relationship of drought-related gene expression in Arabidopsis thaliana to hormonal and environmental factors.
    J. Exp. Bot., 2008. 59(11): p. 2991-3007
    [PMID:18552355]
  11. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  12. Son O, et al.
    ATHB12, an ABA-inducible homeodomain-leucine zipper (HD-Zip) protein of Arabidopsis, negatively regulates the growth of the inflorescence stem by decreasing the expression of a gibberellin 20-oxidase gene.
    Plant Cell Physiol., 2010. 51(9): p. 1537-47
    [PMID:20668225]
  13. Park J, et al.
    The Arabidopsis thaliana homeobox gene ATHB12 is involved in symptom development caused by geminivirus infection.
    PLoS ONE, 2011. 6(5): p. e20054
    [PMID:21625602]
  14. Vald
    The homeodomain-leucine zipper (HD-Zip) class I transcription factors ATHB7 and ATHB12 modulate abscisic acid signalling by regulating protein phosphatase 2C and abscisic acid receptor gene activities.
    Plant Mol. Biol., 2012. 80(4-5): p. 405-18
    [PMID:22968620]
  15. Capella M,R
    Plant homeodomain-leucine zipper I transcription factors exhibit different functional AHA motifs that selectively interact with TBP or/and TFIIB.
    Plant Cell Rep., 2014. 33(6): p. 955-67
    [PMID:24531799]
  16. Lumba S, et al.
    A mesoscale abscisic acid hormone interactome reveals a dynamic signaling landscape in Arabidopsis.
    Dev. Cell, 2014. 29(3): p. 360-72
    [PMID:24823379]
  17. R
    Arabidopsis AtHB7 and AtHB12 evolved divergently to fine tune processes associated with growth and responses to water stress.
    BMC Plant Biol., 2014. 14: p. 150
    [PMID:24884528]
  18. Hur YS, et al.
    Arabidopsis thaliana homeobox 12 (ATHB12), a homeodomain-leucine zipper protein, regulates leaf growth by promoting cell expansion and endoreduplication.
    New Phytol., 2015. 205(1): p. 316-28
    [PMID:25187356]
  19. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  20. Lee YH,Chun JY
    A new homeodomain-leucine zipper gene from Arabidopsis thaliana induced by water stress and abscisic acid treatment.
    Plant Mol. Biol., 1998. 37(2): p. 377-84
    [PMID:9617808]